SCOPe 2.01: Domain d1nf7a4: 1nf7 A:112-231

Lineage for d1nf7a4 (1nf7 A:112-231)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)

8. Domain d1nf7a4: 1nf7 A:112-231 [144359]
   Other proteins in same PDB: d1nf7a1, d1nf7b1
   both CBS motifs are partly disordered in both chains, A and B
   complexed with k, myd, rvp, unk

Details for d1nf7a4

PDB Entry: 1nf7, 2.65 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with Ribavirin Monophosphate and C2-Mycophenolic Adenine Dinucleotide

PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase 2

SCOPe Domain Sequences for d1nf7a4:

Sequence, based on SEQRES records:

>d1nf7a4 d.37.1.1 (A:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeeh
dcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr

Sequence, based on observed residues (ATOM records):

>d1nf7a4 d.37.1.1 (A:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkgiissrdidflehdcfleeimtkredlvvapagitlkeaneilqrsk
kgklpivneddelvaiiartlkknr

Timeline for d1nf7a4:

• d1nf7a4 first appeared in SCOP 1.75
  
• d1nf7a4 appears in SCOPe 2.02
  
• d1nf7a4 appears in the current release, SCOPe 2.08