Lineage for d1nf7a4 (1nf7 A:112-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943353Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 2943359Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)
  8. 2943361Domain d1nf7a4: 1nf7 A:112-231 [144359]
    Other proteins in same PDB: d1nf7a1, d1nf7b1
    both CBS motifs are partly disordered in both chains, A and B
    complexed with k, myd, rvp, unk

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1nf7a4

PDB Entry: 1nf7 (more details), 2.65 Å

PDB Description: Ternary complex of the human type II Inosine Monophosphate Dedhydrogenase with Ribavirin Monophosphate and C2-Mycophenolic Adenine Dinucleotide
PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase 2

SCOPe Domain Sequences for d1nf7a4:

Sequence, based on SEQRES records: (download)

>d1nf7a4 d.37.1.1 (A:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeeh
dcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr

Sequence, based on observed residues (ATOM records): (download)

>d1nf7a4 d.37.1.1 (A:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkgiissrdidflehdcfleeimtkredlvvapagitlkeaneilqrsk
kgklpivneddelvaiiartlkknr

SCOPe Domain Coordinates for d1nf7a4:

Click to download the PDB-style file with coordinates for d1nf7a4.
(The format of our PDB-style files is described here.)

Timeline for d1nf7a4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nf7a1