Lineage for d1jr1a4 (1jr1 A:113-232)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858507Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 858508Superfamily d.37.1: CBS-domain pair [54631] (1 family) (S)
  5. 858509Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 858568Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
    contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals
  7. 858569Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [64260] (1 PDB entry)
  8. 858570Domain d1jr1a4: 1jr1 A:113-232 [144358]
    Other proteins in same PDB: d1jr1a1, d1jr1b1
    complexed with imp, k, moa

Details for d1jr1a4

PDB Entry: 1jr1 (more details), 2.6 Å

PDB Description: crystal structure of inosine monophosphate dehydrogenase in complex with mycophenolic acid
PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase 2

SCOP Domain Sequences for d1jr1a4:

Sequence, based on SEQRES records: (download)

>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
gfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehd
rfleeimtkredlvvapagitlkeaneilqrskkgklpivnendelvaiiartdlkknrd

Sequence, based on observed residues (ATOM records): (download)

>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
gfitdpvvdrvrfeakmgsrlvimtkredlvvapagitlkeaneilqrsklpivnendel
vaiiartdlkknrd

SCOP Domain Coordinates for d1jr1a4:

Click to download the PDB-style file with coordinates for d1jr1a4.
(The format of our PDB-style files is described here.)

Timeline for d1jr1a4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jr1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jr1b1