SCOP 1.75: Domain d1jcnb4: 1jcn B:112-231

Lineage for d1jcnb4 (1jcn B:112-231)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (1 family)

5. Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Human (Homo sapiens), type I [TaxId:9606] [89899] (1 PDB entry)

8. Domain d1jcnb4: 1jcn B:112-231 [144357]
   Other proteins in same PDB: d1jcna1, d1jcnb1
   both CBS motifs are partly disordered in both chains, A and B
   complexed with cpr

Details for d1jcnb4

PDB Entry: 1jcn, 2.5 Å

PDB Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp

PDB Compounds: (B:) inosine monophosphate dehydrogenase I

SCOP Domain Sequences for d1jcnb4:

Sequence, based on SEQRES records:

>d1jcnb4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I [TaxId: 9606]}
qgfitdpvvlspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdidflaekdh
ttllsevmtprielvvapagvtlkeaneilqrskkgklpivndcdelvaiiartdlkknr

Sequence, based on observed residues (ATOM records):

>d1jcnb4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I [TaxId: 9606]}
qgfitdpvvlspgipitevgivtsrdidprielvvapagvtlkeaneilqrskkgklpiv
ndcdelvrtdlkknr

Timeline for d1jcnb4:

• d1jcnb4 is new in SCOP 1.75
  
• d1jcnb4 appears in SCOPe 2.01
  
• d1jcnb4 appears in the current release, SCOPe 2.08