![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species) contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals |
![]() | Species Human (Homo sapiens), type I [TaxId:9606] [89899] (1 PDB entry) |
![]() | Domain d1jcnb4: 1jcn B:112-231 [144357] Other proteins in same PDB: d1jcna1, d1jcnb1 both CBS motifs are partly disordered in both chains, A and B complexed with cpr fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1jcn (more details), 2.5 Å
SCOPe Domain Sequences for d1jcnb4:
Sequence, based on SEQRES records: (download)
>d1jcnb4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I [TaxId: 9606]} qgfitdpvvlspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdidflaekdh ttllsevmtprielvvapagvtlkeaneilqrskkgklpivndcdelvaiiartdlkknr
>d1jcnb4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type I [TaxId: 9606]} qgfitdpvvlspgipitevgivtsrdidprielvvapagvtlkeaneilqrskkgklpiv ndcdelvrtdlkknr
Timeline for d1jcnb4: