Lineage for d1dgr.4 (1dgr N:,M:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 809794Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 809817Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 809827Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 809834Domain d1dgr.4: 1dgr N:,M: [144355]

Details for d1dgr.4

PDB Entry: 1dgr (more details), 2.6 Å

PDB Description: Refined crystal structure of canavalin from jack bean
PDB Compounds: (M:) canavalin, (N:) canavalin

SCOP Domain Sequences for d1dgr.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dgr.4 b.82.1.2 (N:,M:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvgleXqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenn
ernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp

SCOP Domain Coordinates for d1dgr.4:

Click to download the PDB-style file with coordinates for d1dgr.4.
(The format of our PDB-style files is described here.)

Timeline for d1dgr.4: