SCOPe 2.07: Domain d1b3ob4: 1b3o B:112-231

Lineage for d1b3ob4 (1b3o B:112-231)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Type II inosine monophosphate dehydrogenase CBS domains [54633] (4 species)
   contains tandem repeat of two CBS domains inserted into the catalytic TIM-barrel domain; may be disordered in the crystals

7. Species Human (Homo sapiens), type II [TaxId:9606] [54634] (3 PDB entries)

8. Domain d1b3ob4: 1b3o B:112-231 [144354]
   Other proteins in same PDB: d1b3oa1, d1b3ob1
   complexed with cpr, sae, unx

Details for d1b3ob4

PDB Entry: 1b3o, 2.9 Å

PDB Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide

PDB Compounds: (B:) protein (inosine monophosphate dehydrogenase 2)

SCOPe Domain Sequences for d1b3ob4:

Sequence, based on SEQRES records:

>d1b3ob4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeeh
dcfleeimtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr

Sequence, based on observed residues (ATOM records):

>d1b3ob4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}
qgfitdpvvlspkdrvrdcgipitdtgrmgsrlvgiisimtkredlvvapagitlkeane
ilqrskkgklpivneddelvaiiartdlkknr

Timeline for d1b3ob4:

• d1b3ob4 first appeared in SCOP 1.75
  
• d1b3ob4 appears in SCOPe 2.06
  
• d1b3ob4 appears in the current release, SCOPe 2.08