SCOPe 2.06: Domain d2z0eb_: 2z0e B:

Lineage for d2z0eb_ (2z0e B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187189] (3 PDB entries)

8. Domain d2z0eb_: 2z0e B: [140097]
   Other proteins in same PDB: d2z0ea_
   automated match to d1v49a_

Details for d2z0eb_

PDB Entry: 2z0e, 1.9 Å

PDB Description: the crystal structure of human atg4b- lc3(1-124) complex

PDB Compounds: (B:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d2z0eb_:

Sequence; same for both SEQRES and ATOM records:

>d2z0eb_ d.15.1.3 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfgta

Timeline for d2z0eb_:

• d2z0eb_ first appeared in SCOP 1.73, called d2z0eb1
  
• d2z0eb_ appears in SCOPe 2.05
  
• d2z0eb_ appears in SCOPe 2.07
  
• d2z0eb_ appears in the current release, SCOPe 2.08