Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
Protein automated matches [190358] (5 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187189] (3 PDB entries) |
Domain d2z0eb_: 2z0e B: [140097] Other proteins in same PDB: d2z0ea_ automated match to d1v49a_ |
PDB Entry: 2z0e (more details), 1.9 Å
SCOPe Domain Sequences for d2z0eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0eb_ d.15.1.3 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfgta
Timeline for d2z0eb_: