![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Enoyl-ACP reductase [51791] (6 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117409] (2 PDB entries) Uniprot Q5SLI9 |
![]() | Domain d2yw9c1: 2yw9 C:1-256 [140089] automatically matched to d1ulud_ complexed with nap |
PDB Entry: 2yw9 (more details), 2.5 Å
SCOP Domain Sequences for d2yw9c1:
Sequence, based on SEQRES records: (download)
>d2yw9c1 c.2.1.2 (C:1-256) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg itgevvyvdagyhimg
>d2yw9c1 c.2.1.2 (C:1-256) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp kgvrvnaisagpvydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhi mg
Timeline for d2yw9c1: