Lineage for d2yvcc2 (2yvc C:199-296)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. Protein Radixin [50779] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)
  8. Domain d2yvcc2: 2yvc C:199-296 [140085]
    Other proteins in same PDB: d2yvca1, d2yvca3, d2yvcb1, d2yvcb3, d2yvcb4, d2yvcc1, d2yvcc3
    automatically matched to d1gc6a2

Details for d2yvcc2

PDB Entry: 2yvc (more details), 3.2 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail
PDB Compounds: (C:) Radixin

SCOPe Domain Sequences for d2yvcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvcc2 b.55.1.5 (C:199-296) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrk

SCOPe Domain Coordinates for d2yvcc2 are not available.

Timeline for d2yvcc2:

Domains from same chain:
(mouse over for more information)
d2yvcc1, d2yvcc3
Domains from other chains:
(mouse over for more information)
d2yvca1, d2yvca2, d2yvca3, d2yvcb1, d2yvcb2, d2yvcb3, d2yvcb4