![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
![]() | Protein Radixin [47035] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries) |
![]() | Domain d2yvcb1: 2yvc B:88-198 [140081] Other proteins in same PDB: d2yvca2, d2yvca3, d2yvcb2, d2yvcb3, d2yvcb4, d2yvcc2, d2yvcc3 automatically matched to d1gc6a1 |
PDB Entry: 2yvc (more details), 3.2 Å
SCOPe Domain Sequences for d2yvcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvcb1 a.11.2.1 (B:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]} dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl
Timeline for d2yvcb1: