Lineage for d2yvca3 (2yvc A:3-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932854Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 2932884Protein Radixin [54259] (1 species)
  7. 2932885Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries)
  8. 2932899Domain d2yvca3: 2yvc A:3-87 [140080]
    Other proteins in same PDB: d2yvca1, d2yvca2, d2yvcb1, d2yvcb2, d2yvcb4, d2yvcc1, d2yvcc2
    automatically matched to d1gc6a3

Details for d2yvca3

PDB Entry: 2yvc (more details), 3.2 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2yvca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvca3 d.15.1.4 (A:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

SCOPe Domain Coordinates for d2yvca3:

Click to download the PDB-style file with coordinates for d2yvca3.
(The format of our PDB-style files is described here.)

Timeline for d2yvca3: