Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Radixin [50779] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries) |
Domain d2yvca2: 2yvc A:199-297 [140079] Other proteins in same PDB: d2yvca1, d2yvca3, d2yvcb1, d2yvcb3, d2yvcb4, d2yvcc1, d2yvcc3 automatically matched to d1gc6a2 |
PDB Entry: 2yvc (more details), 3.2 Å
SCOPe Domain Sequences for d2yvca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvca2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d2yvca2: