Lineage for d2yvca2 (2yvc A:199-297)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803543Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2803573Protein Radixin [50779] (1 species)
  7. 2803574Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)
  8. 2803588Domain d2yvca2: 2yvc A:199-297 [140079]
    Other proteins in same PDB: d2yvca1, d2yvca3, d2yvcb1, d2yvcb3, d2yvcb4, d2yvcc1, d2yvcc3
    automatically matched to d1gc6a2

Details for d2yvca2

PDB Entry: 2yvc (more details), 3.2 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2yvca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvca2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOPe Domain Coordinates for d2yvca2:

Click to download the PDB-style file with coordinates for d2yvca2.
(The format of our PDB-style files is described here.)

Timeline for d2yvca2: