![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [53962] (256 PDB entries) |
![]() | Domain d2yvba1: 2yvb A:1-129 [140077] automatically matched to d1lsg_1 |
PDB Entry: 2yvb (more details), 1.62 Å
SCOP Domain Sequences for d2yvba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvba1 d.2.1.2 (A:1-129) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d2yvba1: