Lineage for d2yu9j1 (2yu9 J:1-65)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636147Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 636148Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 636149Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 636152Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (24 PDB entries)
  8. 636174Domain d2yu9j1: 2yu9 J:1-65 [140074]
    Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9k1, d2yu9l1
    automatically matched to d1i3qj_
    complexed with mg, utp, zn

Details for d2yu9j1

PDB Entry: 2yu9 (more details), 3.4 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with utp
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOP Domain Sequences for d2yu9j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yu9j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d2yu9j1:

Click to download the PDB-style file with coordinates for d2yu9j1.
(The format of our PDB-style files is described here.)

Timeline for d2yu9j1: