![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (4 proteins) |
![]() | Protein RBP9 subunit of RNA polymerase II [57787] (2 species) contains two differently decorated domains of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
![]() | Domain d2yu9i2: 2yu9 I:50-120 [140073] Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9j1, d2yu9k1, d2yu9l1 automatically matched to d1i3qi2 complexed with mg, utp, zn |
PDB Entry: 2yu9 (more details), 3.4 Å
SCOP Domain Sequences for d2yu9i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yu9i2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi ftsdqknkrtq
Timeline for d2yu9i2: