![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 automatically mapped to Pfam PF03870 |
![]() | Protein RNA polymerase subunit RBP8 [50322] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries) Uniprot P20436 |
![]() | Domain d2yu9h1: 2yu9 H:2-146 [140071] Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1 automatically matched to d1a1d__ protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn |
PDB Entry: 2yu9 (more details), 3.4 Å
SCOPe Domain Sequences for d2yu9h1:
Sequence, based on SEQRES records: (download)
>d2yu9h1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl lmrlegnyrnlnnlkqenayllirr
>d2yu9h1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln nlkqenayllirr
Timeline for d2yu9h1: