![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) ![]() automatically mapped to Pfam PF01191 |
![]() | Family d.78.1.1: RPB5 [55288] (2 proteins) |
![]() | Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries) Uniprot P20434; part of multichain biological unit |
![]() | Domain d2yu9e2: 2yu9 E:144-215 [140069] Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1 automatically matched to d1dzfa2 protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn |
PDB Entry: 2yu9 (more details), 3.4 Å
SCOPe Domain Sequences for d2yu9e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yu9e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d2yu9e2: