Lineage for d2yu9e2 (2yu9 E:144-215)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727252Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 727253Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) (S)
  5. 727254Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 727255Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)
  7. 727256Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
  8. 727279Domain d2yu9e2: 2yu9 E:144-215 [140069]
    Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e1, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1
    automatically matched to d1dzfa2
    complexed with mg, utp, zn

Details for d2yu9e2

PDB Entry: 2yu9 (more details), 3.4 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with utp
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2yu9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yu9e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOP Domain Coordinates for d2yu9e2:

Click to download the PDB-style file with coordinates for d2yu9e2.
(The format of our PDB-style files is described here.)

Timeline for d2yu9e2: