| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
| Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein) |
| Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries) Uniprot P20434; part of multichain biological unit |
| Domain d2yu9e1: 2yu9 E:2-143 [140068] Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c1, d2yu9c2, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1 automatically matched to d1i3qe1 complexed with mg, utp, zn |
PDB Entry: 2yu9 (more details), 3.4 Å
SCOP Domain Sequences for d2yu9e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yu9e1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn
Timeline for d2yu9e1: