SCOPe 2.06: Domain d2yu9c1: 2yu9 C:3-37,C:173-268

Lineage for d2yu9c1 (2yu9 C:3-37,C:173-268)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d2yu9c1: 2yu9 C:3-37,C:173-268 [140066]
   Other proteins in same PDB: d2yu9a1, d2yu9b1, d2yu9c2, d2yu9e1, d2yu9e2, d2yu9f1, d2yu9h1, d2yu9i1, d2yu9i2, d2yu9j1, d2yu9k1, d2yu9l1
   automatically matched to d1i3qc1
   protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2yu9c1

PDB Entry: 2yu9, 3.4 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with utp

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2yu9c1:

Sequence; same for both SEQRES and ATOM records:

>d2yu9c1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

Timeline for d2yu9c1:

• d2yu9c1 first appeared in SCOP 1.73
  
• d2yu9c1 appears in SCOPe 2.05
  
• d2yu9c1 appears in SCOPe 2.07
  
• d2yu9c1 appears in the current release, SCOPe 2.08