![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Myoglobin [46469] (10 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries) |
![]() | Domain d2v1ka_: 2v1k A: [140060] automated match to d1azi__ complexed with gol, hem, so4 |
PDB Entry: 2v1k (more details), 1.25 Å
SCOPe Domain Sequences for d2v1ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v1ka_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]} glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp gdfgadaqgamtkalelfrndiaakykelgfqg
Timeline for d2v1ka_: