SCOP 1.73: Domain d2v1ka1: 2v1k A:1-152

Lineage for d2v1ka1 (2v1k A:1-152)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (32 PDB entries)

8. Domain d2v1ka1: 2v1k A:1-152 [140060]
   automatically matched to d1azi__
   complexed with gol, hem, so4

Details for d2v1ka1

PDB Entry: 2v1k, 1.25 Å

PDB Description: crystal structure of ferrous deoxymyoglobin at ph 6.8

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2v1ka1:

Sequence; same for both SEQRES and ATOM records:

>d2v1ka1 a.1.1.2 (A:1-152) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

Timeline for d2v1ka1:

• d2v1ka1 is new in SCOP 1.73
  
• d2v1ka1 appears in SCOP 1.75
  
• d2v1ka1 appears in the current release, SCOPe 2.08, called d2v1ka_