SCOPe 2.07: Domain d2v1ia_: 2v1i A:

Lineage for d2v1ia_ (2v1i A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)

8. Domain d2v1ia_: 2v1i A: [140058]
   automated match to d1azi__
   complexed with gol, hem, so4

Details for d2v1ia_

PDB Entry: 2v1i, 1.2 Å

PDB Description: crystal structure of radiation-induced metmyoglobin - aqua ferrous myoglobin at ph 6.8

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2v1ia_:

Sequence; same for both SEQRES and ATOM records:

>d2v1ia_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d2v1ia_:

• d2v1ia_ first appeared in SCOP 1.73, called d2v1ia1
  
• d2v1ia_ appears in SCOPe 2.06
  
• d2v1ia_ appears in the current release, SCOPe 2.08