Lineage for d2v1ha1 (2v1h A:1-152)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632833Protein Myoglobin [46469] (9 species)
  7. 632838Species Horse (Equus caballus) [TaxId:9796] [46474] (32 PDB entries)
  8. 632843Domain d2v1ha1: 2v1h A:1-152 [140057]
    automatically matched to d1azi__
    complexed with gol, hem, so4

Details for d2v1ha1

PDB Entry: 2v1h (more details), 1.3 Å

PDB Description: crystal structure of radiation-induced metmyoglobin - aqua ferrous myoglobin at ph 5.2
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2v1ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v1ha1 a.1.1.2 (A:1-152) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq

SCOP Domain Coordinates for d2v1ha1:

Click to download the PDB-style file with coordinates for d2v1ha1.
(The format of our PDB-style files is described here.)

Timeline for d2v1ha1: