Lineage for d2uz3b2 (2uz3 B:150-217)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705625Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
    C-terminal part of Pfam PF00265
  6. 1705626Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)
  7. 1705643Species Ureaplasma urealyticum [TaxId:2130] [118279] (2 PDB entries)
    Uniprot Q9PPP5 11-211
  8. 1705649Domain d2uz3b2: 2uz3 B:150-217 [140043]
    Other proteins in same PDB: d2uz3a1, d2uz3b1, d2uz3c1, d2uz3d1
    complexed with mg, ttp, zn

Details for d2uz3b2

PDB Entry: 2uz3 (more details), 2.5 Å

PDB Description: crystal structure of thymidine kinase with dttp from u. urealyticum
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d2uz3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uz3b2 g.39.1.14 (B:150-217) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee
fikffknk

SCOPe Domain Coordinates for d2uz3b2:

Click to download the PDB-style file with coordinates for d2uz3b2.
(The format of our PDB-style files is described here.)

Timeline for d2uz3b2: