SCOPe 2.04: Domain d2uyzb_: 2uyz B:

Lineage for d2uyzb_ (2uyz B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)

8. Domain d2uyzb_: 2uyz B: [140039]
   Other proteins in same PDB: d2uyza1
   automated match to d2ckhb1
   complexed with na

Details for d2uyzb_

PDB Entry: 2uyz, 1.4 Å

PDB Description: non-covalent complex between ubc9 and sumo1

PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2uyzb_:

Sequence; same for both SEQRES and ATOM records:

>d2uyzb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
elgmeeedvievyqeqtg

Timeline for d2uyzb_:

• d2uyzb_ first appeared in SCOP 1.73, called d2uyzb1
  
• d2uyzb_ appears in SCOPe 2.03
  
• d2uyzb_ appears in SCOPe 2.05
  
• d2uyzb_ appears in the current release, SCOPe 2.08