| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54242] (12 PDB entries) Uniprot Q93068 |
| Domain d2uyzb1: 2uyz B:20-96 [140039] Other proteins in same PDB: d2uyza1 automatically matched to d1tgzb_ complexed with na |
PDB Entry: 2uyz (more details), 1.4 Å
SCOPe Domain Sequences for d2uyzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtg
Timeline for d2uyzb1: