Lineage for d2uyzb_ (2uyz B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933174Domain d2uyzb_: 2uyz B: [140039]
    Other proteins in same PDB: d2uyza1
    automated match to d2ckhb1
    complexed with na

Details for d2uyzb_

PDB Entry: 2uyz (more details), 1.4 Å

PDB Description: non-covalent complex between ubc9 and sumo1
PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2uyzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyzb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
elgmeeedvievyqeqtg

SCOPe Domain Coordinates for d2uyzb_:

Click to download the PDB-style file with coordinates for d2uyzb_.
(The format of our PDB-style files is described here.)

Timeline for d2uyzb_: