Lineage for d2uyib1 (2uyi B:18-362)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696444Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 696445Protein Kinesin [52646] (7 species)
  7. 696449Species Human (Homo sapiens), mitotic kinesin eg5 [TaxId:9606] [64018] (14 PDB entries)
  8. 696465Domain d2uyib1: 2uyi B:18-362 [140036]
    automatically matched to d1q0bb_
    complexed with adp, k02, mg

Details for d2uyib1

PDB Entry: 2uyi (more details), 2.1 Å

PDB Description: crystal structure of ksp in complex with adp and thiophene containing inhibitor 33
PDB Compounds: (B:) Kinesin-like protein KIF11

SCOP Domain Sequences for d2uyib1:

Sequence, based on SEQRES records: (download)

>d2uyib1 c.37.1.9 (B:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresklt
rilqdslggrtrtsiiatispaslnleetlstleyahraknilnk

Sequence, based on observed residues (ATOM records): (download)

>d2uyib1 c.37.1.9 (B:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagseninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsii
atispaslnleetlstleyahraknilnk

SCOP Domain Coordinates for d2uyib1:

Click to download the PDB-style file with coordinates for d2uyib1.
(The format of our PDB-style files is described here.)

Timeline for d2uyib1: