SCOPe 2.04: Domain d2uy7g2: 2uy7 G:125-217

Lineage for d2uy7g2 (2uy7 G:125-217)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.7: C2 domain-like [49561] (5 superfamilies)
sandwich; 8 strands in 2 sheets; greek-key
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
Protein PapD [49586] (1 species)
Species Escherichia coli [TaxId:562] [49587] (14 PDB entries)
Domain d2uy7g2: 2uy7 G:125-217 [140034]
Other proteins in same PDB: d2uy7a1, d2uy7b1, d2uy7c1, d2uy7d_, d2uy7e1, d2uy7f_, d2uy7g1, d2uy7h_
automated match to d1pdka2
complexed with so4

Details for d2uy7g2

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa

PDB Compounds: (G:) periplasmid chaperone papd protein

SCOPe Domain Sequences for d2uy7g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy7g2 b.7.2.1 (G:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke

SCOPe Domain Coordinates for d2uy7g2:

Click to download the PDB-style file with coordinates for d2uy7g2.
(The format of our PDB-style files is described here.)

Timeline for d2uy7g2: