Lineage for d2uy7g2 (2uy7 G:125-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773205Protein PapD [49586] (1 species)
  7. 2773206Species Escherichia coli [TaxId:562] [49587] (15 PDB entries)
  8. 2773220Domain d2uy7g2: 2uy7 G:125-217 [140034]
    Other proteins in same PDB: d2uy7a1, d2uy7b1, d2uy7c1, d2uy7d_, d2uy7e1, d2uy7f_, d2uy7g1, d2uy7h_
    automated match to d1pdka2
    complexed with so4

Details for d2uy7g2

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (G:) periplasmid chaperone papd protein

SCOPe Domain Sequences for d2uy7g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy7g2 b.7.2.1 (G:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke

SCOPe Domain Coordinates for d2uy7g2:

Click to download the PDB-style file with coordinates for d2uy7g2.
(The format of our PDB-style files is described here.)

Timeline for d2uy7g2: