Lineage for d2uy7e2 (2uy7 E:125-217)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1115534Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1115687Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 1115688Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1115729Protein PapD [49586] (1 species)
  7. 1115730Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)
  8. 1115742Domain d2uy7e2: 2uy7 E:125-217 [140032]
    Other proteins in same PDB: d2uy7a1, d2uy7b1, d2uy7c1, d2uy7d_, d2uy7e1, d2uy7f_, d2uy7g1, d2uy7h_
    automatically matched to d3dpa_2
    complexed with so4

Details for d2uy7e2

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (E:) periplasmid chaperone papd protein

SCOPe Domain Sequences for d2uy7e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy7e2 b.7.2.1 (E:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke

SCOPe Domain Coordinates for d2uy7e2:

Click to download the PDB-style file with coordinates for d2uy7e2.
(The format of our PDB-style files is described here.)

Timeline for d2uy7e2: