![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (2 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.1: Pilus chaperone [49355] (4 proteins) |
![]() | Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
![]() | Species Escherichia coli [TaxId:562] [49357] (9 PDB entries) |
![]() | Domain d2uy7e1: 2uy7 E:1-124 [140031] Other proteins in same PDB: d2uy7a2, d2uy7c2, d2uy7e2, d2uy7g2 automatically matched to d3dpa_1 complexed with so4; mutant |
PDB Entry: 2uy7 (more details), 2.6 Å
SCOP Domain Sequences for d2uy7e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uy7e1 b.1.11.1 (E:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai ktrp
Timeline for d2uy7e1: