SCOP 1.73: Domain d2uy7e1: 2uy7 E:1-124

Lineage for d2uy7e1 (2uy7 E:1-124)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (4 proteins)

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (9 PDB entries)

8. Domain d2uy7e1: 2uy7 E:1-124 [140031]
   Other proteins in same PDB: d2uy7a2, d2uy7c2, d2uy7e2, d2uy7g2
   automatically matched to d3dpa_1
   complexed with so4; mutant

Details for d2uy7e1

PDB Entry: 2uy7, 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa

PDB Compounds: (E:) periplasmid chaperone papd protein

SCOP Domain Sequences for d2uy7e1:

Sequence; same for both SEQRES and ATOM records:

>d2uy7e1 b.1.11.1 (E:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Timeline for d2uy7e1:

• d2uy7e1 is new in SCOP 1.73
  
• d2uy7e1 appears in SCOP 1.75
  
• d2uy7e1 appears in the current release, SCOPe 2.08