Lineage for d2uy7e1 (2uy7 E:1-124)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764597Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2764658Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 2764659Species Escherichia coli [TaxId:562] [49357] (15 PDB entries)
  8. 2764672Domain d2uy7e1: 2uy7 E:1-124 [140031]
    Other proteins in same PDB: d2uy7a2, d2uy7b1, d2uy7c2, d2uy7d_, d2uy7e2, d2uy7f_, d2uy7g2, d2uy7h_
    automated match to d1pdka1
    complexed with so4

Details for d2uy7e1

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (E:) periplasmid chaperone papd protein

SCOPe Domain Sequences for d2uy7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy7e1 b.1.11.1 (E:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

SCOPe Domain Coordinates for d2uy7e1:

Click to download the PDB-style file with coordinates for d2uy7e1.
(The format of our PDB-style files is described here.)

Timeline for d2uy7e1: