Class b: All beta proteins [48724] (174 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) |
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
Protein PapD [49586] (1 species) |
Species Escherichia coli [TaxId:562] [49587] (14 PDB entries) |
Domain d2uy7c2: 2uy7 C:125-217 [140030] Other proteins in same PDB: d2uy7a1, d2uy7b1, d2uy7c1, d2uy7d_, d2uy7e1, d2uy7f_, d2uy7g1, d2uy7h_ automated match to d1pdka2 complexed with so4 |
PDB Entry: 2uy7 (more details), 2.6 Å
SCOPe Domain Sequences for d2uy7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uy7c2 b.7.2.1 (C:125-217) PapD {Escherichia coli [TaxId: 562]} nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa nyntpylsyindyggrpvlsficngsrcsvkke
Timeline for d2uy7c2: