Lineage for d2uy7a2 (2uy7 A:125-217)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792269Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 792270Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 792311Protein PapD [49586] (1 species)
  7. 792312Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)
  8. 792323Domain d2uy7a2: 2uy7 A:125-217 [140028]
    Other proteins in same PDB: d2uy7a1, d2uy7b1, d2uy7c1, d2uy7d1, d2uy7e1, d2uy7f1, d2uy7g1, d2uy7h1
    automatically matched to d3dpa_2
    complexed with so4; mutant

Details for d2uy7a2

PDB Entry: 2uy7 (more details), 2.6 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (A:) periplasmid chaperone papd protein

SCOP Domain Sequences for d2uy7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy7a2 b.7.2.1 (A:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke

SCOP Domain Coordinates for d2uy7a2:

Click to download the PDB-style file with coordinates for d2uy7a2.
(The format of our PDB-style files is described here.)

Timeline for d2uy7a2: