SCOP 1.75: Domain d2uy6a2: 2uy6 A:125-217

Lineage for d2uy6a2 (2uy6 A:125-217)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein PapD [49586] (1 species)

7. Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)

8. Domain d2uy6a2: 2uy6 A:125-217 [140026]
   Other proteins in same PDB: d2uy6a1, d2uy6b1
   automatically matched to d3dpa_2
   mutant

Details for d2uy6a2

PDB Entry: 2uy6, 2.5 Å

PDB Description: crystal structure of the p pilus rod subunit papa

PDB Compounds: (A:) periplasmid chaperone papd protein

SCOP Domain Sequences for d2uy6a2:

Sequence; same for both SEQRES and ATOM records:

>d2uy6a2 b.7.2.1 (A:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke

Timeline for d2uy6a2:

• d2uy6a2 first appeared in SCOP 1.73
  
• d2uy6a2 appears in SCOPe 2.01
  
• d2uy6a2 appears in the current release, SCOPe 2.08