| Class b: All beta proteins [48724] (174 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) ![]() |
| Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
| Protein PapD [49586] (1 species) |
| Species Escherichia coli [TaxId:562] [49587] (9 PDB entries) |
| Domain d2uy6a2: 2uy6 A:125-217 [140026] Other proteins in same PDB: d2uy6a1, d2uy6b1 automatically matched to d3dpa_2 mutant |
PDB Entry: 2uy6 (more details), 2.5 Å
SCOP Domain Sequences for d2uy6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uy6a2 b.7.2.1 (A:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke
Timeline for d2uy6a2: