SCOPe 2.07: Domain d2uy6a1: 2uy6 A:1-124

Lineage for d2uy6a1 (2uy6 A:1-124)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (15 PDB entries)

8. Domain d2uy6a1: 2uy6 A:1-124 [140025]
   Other proteins in same PDB: d2uy6a2, d2uy6b1, d2uy6c_
   automated match to d1pdka1

Details for d2uy6a1

PDB Entry: 2uy6, 2.5 Å

PDB Description: crystal structure of the p pilus rod subunit papa

PDB Compounds: (A:) periplasmid chaperone papd protein

SCOPe Domain Sequences for d2uy6a1:

Sequence; same for both SEQRES and ATOM records:

>d2uy6a1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Timeline for d2uy6a1:

• d2uy6a1 first appeared in SCOP 1.73
  
• d2uy6a1 appears in SCOPe 2.06
  
• d2uy6a1 appears in the current release, SCOPe 2.08