Lineage for d2uy6a1 (2uy6 A:1-124)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111327Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 1111328Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 1111377Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 1111378Species Escherichia coli [TaxId:562] [49357] (9 PDB entries)
  8. 1111386Domain d2uy6a1: 2uy6 A:1-124 [140025]
    Other proteins in same PDB: d2uy6a2, d2uy6b1, d2uy6c_
    automatically matched to d3dpa_1

Details for d2uy6a1

PDB Entry: 2uy6 (more details), 2.5 Å

PDB Description: crystal structure of the p pilus rod subunit papa
PDB Compounds: (A:) periplasmid chaperone papd protein

SCOPe Domain Sequences for d2uy6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uy6a1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

SCOPe Domain Coordinates for d2uy6a1:

Click to download the PDB-style file with coordinates for d2uy6a1.
(The format of our PDB-style files is described here.)

Timeline for d2uy6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uy6a2