Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
Domain d2uxcr1: 2uxc R:19-88 [140021] Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcs1, d2uxct1, d2uxcu1 automatically matched to 2J00 R:19-88 protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxc (more details), 2.9 Å
SCOPe Domain Sequences for d2uxcr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxcr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl lpfteklvrk
Timeline for d2uxcr1: