![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries) Uniprot P24321 |
![]() | Domain d2uxcq1: 2uxc Q:2-105 [140020] Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1 automatically matched to d1fjgq_ protein/RNA complex; complexed with k, mg, par, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2uxc (more details), 2.9 Å
SCOPe Domain Sequences for d2uxcq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxcq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d2uxcq1: