Lineage for d2uxcj1 (2uxc J:3-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953733Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2953734Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2953735Protein Ribosomal protein S10 [55001] (2 species)
  7. 2953761Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 2953774Domain d2uxcj1: 2uxc J:3-100 [140013]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
    automatically matched to d1fjgj_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxcj1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (J:) ribosomal protein s10

SCOPe Domain Sequences for d2uxcj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxcj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2uxcj1:

Click to download the PDB-style file with coordinates for d2uxcj1.
(The format of our PDB-style files is described here.)

Timeline for d2uxcj1: