Lineage for d2uxch1 (2uxc H:1-138)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1670846Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1670847Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 1670848Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1670849Protein Ribosomal protein S8 [56049] (4 species)
  7. 1670867Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1670877Domain d2uxch1: 2uxc H:1-138 [140011]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
    automatically matched to d1fjgh_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxch1

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (H:) ribosomal protein s8

SCOPe Domain Sequences for d2uxch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxch1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2uxch1:

Click to download the PDB-style file with coordinates for d2uxch1.
(The format of our PDB-style files is described here.)

Timeline for d2uxch1: