| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
| Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
| Protein Ribosomal protein S6 [54997] (4 species) |
| Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
| Domain d2uxcf1: 2uxc F:1-101 [140009] Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxce2, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1 automatically matched to d1fjgf_ protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uxc (more details), 2.9 Å
SCOPe Domain Sequences for d2uxcf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxcf1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2uxcf1: