SCOPe 2.08: Domain d2uxce2: 2uxc E:5-73

Lineage for d2uxce2 (2uxc E:5-73)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
   automatically mapped to Pfam PF00333

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
   Uniprot P27152

8. Domain d2uxce2: 2uxc E:5-73 [140008]
   Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcc2, d2uxcd1, d2uxce1, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
   automatically matched to d1i94e2
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxce2

PDB Entry: 2uxc, 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.

PDB Compounds: (E:) ribosomal protein s5

SCOPe Domain Sequences for d2uxce2:

Sequence; same for both SEQRES and ATOM records:

>d2uxce2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d2uxce2:

• d2uxce2 first appeared in SCOP 1.73
  
• d2uxce2 appears in SCOPe 2.07