SCOPe 2.01: Domain d2uxcc2: 2uxc C:107-207

Lineage for d2uxcc2 (2uxc C:107-207)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d2uxcc2: 2uxc C:107-207 [140005]
   Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1, d2uxcu1
   automatically matched to d1fjgc2
   protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxcc2

PDB Entry: 2uxc, 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.

PDB Compounds: (C:) ribosomal protein s3

SCOPe Domain Sequences for d2uxcc2:

Sequence; same for both SEQRES and ATOM records:

>d2uxcc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d2uxcc2:

• d2uxcc2 first appeared in SCOP 1.73
  
• d2uxcc2 appears in SCOP 1.75
  
• d2uxcc2 appears in SCOPe 2.02
  
• d2uxcc2 appears in the current release, SCOPe 2.08