Lineage for d2uxcc2 (2uxc C:107-207)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722852Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 722853Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 722854Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 722855Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 722856Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
  8. 722870Domain d2uxcc2: 2uxc C:107-207 [140005]
    Other proteins in same PDB: d2uxcb1, d2uxcc1, d2uxcd1, d2uxce1, d2uxce2, d2uxcf1, d2uxcg1, d2uxch1, d2uxci1, d2uxcj1, d2uxck1, d2uxcl1, d2uxcm1, d2uxcn1, d2uxco1, d2uxcp1, d2uxcq1, d2uxcr1, d2uxcs1, d2uxct1
    automatically matched to d1fjgc2
    complexed with k, mg, par, zn

Details for d2uxcc2

PDB Entry: 2uxc (more details), 2.9 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (C:) ribosomal protein s3

SCOP Domain Sequences for d2uxcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxcc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d2uxcc2:

Click to download the PDB-style file with coordinates for d2uxcc2.
(The format of our PDB-style files is described here.)

Timeline for d2uxcc2: