![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Penicillin-binding protein 1b, transpeptidase domain [144036] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [144037] (3 PDB entries) Uniprot O70038 337-789! Uniprot O70038 337-791 |
![]() | Domain d2uwxa1: 2uwx A:337-790 [140002] automatically matched to 2BG3 A:337-791 complexed with cl, edo, so4 |
PDB Entry: 2uwx (more details), 2.39 Å
SCOPe Domain Sequences for d2uwxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uwxa1 e.3.1.1 (A:337-790) Penicillin-binding protein 1b, transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} dylyfttlaeaqermydylaqrdnvsakelkneatqkfyrdlaakeienggykitttidq kihsamqsavadygyllddgtgrvevgnvlmdnqtgailgfvggrnyqenqnnhafdtkr spasttkpllaygiaidqglmgsetilsnyptnfangnpimyanskgtgmmtlgealnys wnipaywtyrmlrengvdvkgymekmgyeipeygieslpmgggievtvaqhtngyqtlan ngvyhqkhviskieaadgrvvyeyqdkpvqvyskatatimqgllrevlssrvtttfksnl tslnptlanadwigktgttnqdenmwlmlstprltlggwighddnhslsqqagysnnsny mahlvnaiqqaspsiwgnerfaldpsvvksevlkstgqkpgkvsvegkevevtgstvtsy wanksgapatsyrfaiggsdadyqnawssivgsl
Timeline for d2uwxa1: