SCOPe 2.07: Domain d2uwmb3: 2uwm B:575-633

Lineage for d2uwmb3 (2uwm B:575-633)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins)

6. Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
   duplication: tandem repeat of four "winged helix" domains
7. Species Moorella thermoacetica [TaxId:1525] [74685] (4 PDB entries)

8. Domain d2uwmb3: 2uwm B:575-633 [139997]
   automatically matched to d1lvaa4
   protein/RNA complex

Details for d2uwmb3

PDB Entry: 2uwm, 2.31 Å

PDB Description: c-terminal domain(wh2-wh4) of elongation factor selb in complex with secis rna

PDB Compounds: (B:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d2uwmb3:

Sequence; same for both SEQRES and ATOM records:

>d2uwmb3 a.4.5.35 (B:575-633) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvg

Timeline for d2uwmb3:

• d2uwmb3 first appeared in SCOP 1.73
  
• d2uwmb3 appears in SCOPe 2.06
  
• d2uwmb3 appears in the current release, SCOPe 2.08